PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 292aa    MW: 33768.9 Da    PI: 6.521
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606198.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.32.9e-5391341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+ +++++++++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra+ sgyWkatg+dk+++s 
  XP_009606198.1   9 LPPGFRFHPTDEELIMYYLRYQATSRPCPV-SIIPEVDLYKFDPWELPEKAEFGENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS- 101
                     79****************************.89***************99999*****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++ vg+kk Lvfykg+ pkg+ktdW+mheyrl
  XP_009606198.1 102 ASKYVGVKKALVFYKGKPPKGVKTDWIMHEYRL 134
                     9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-655161IPR003441NAC domain
PROSITE profilePS5100560.9359161IPR003441NAC domain
PfamPF023655.2E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVGKISSDLP PGFRFHPTDE ELIMYYLRYQ ATSRPCPVSI IPEVDLYKFD PWELPEKAEF  60
GENEWYFFTP RDRKYPNGVR PNRAAVSGYW KATGTDKAIY SASKYVGVKK ALVFYKGKPP  120
KGVKTDWIMH EYRLNESRSQ PNKQSGSMRL DDWVLCRIYK KKNLGKTMEM MKAEEEEESE  180
AQIEITNNDI EVGATTSGPQ TSKLPRNCSL SHLLELDYFG SIPQLLGDNS YHTSFDNDQS  240
YTLMNNVNTN VVHQMEKSQL GEVSHQYNSQ NNNYNIFFNQ QPVFVNPAFQ FQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-73816314170Stress-induced transcription factor NAC1
4dul_B1e-72916317167NAC domain-containing protein 19
4dul_A1e-72916317167NAC domain-containing protein 19
1ut7_B1e-72916317167NO APICAL MERISTEM PROTEIN
1ut7_A1e-72916317167NO APICAL MERISTEM PROTEIN
1ut4_B1e-72916317167NO APICAL MERISTEM PROTEIN
1ut4_A1e-72916317167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606198.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-110NAC29_ARATH; NAC transcription factor 29
TrEMBLK4BWV21e-163K4BWV2_SOLLC; Uncharacterized protein
STRINGSolyc05g007770.2.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-106NAC-like, activated by AP3/PI